General Information

  • ID:  hor000812
  • Uniprot ID:  Q5DW47
  • Protein name:  Pro-corazonin (Potential)
  • Gene name:  Crz
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Corazonin family
  • Source:  animal
  • Expression:  In the adult brain, expressed in four neurons of the lateral protocerebrum project axons towards the retrocerebral complex.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY
  • Length:  86(22-107)
  • Propeptide:  MVNSQILILFILSLTITIVMCQTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY
  • Signal peptide:  MVNSQILILFILSLTITIVMC
  • Modification:  T1 Pyrrolidone carboxylic acid;T11 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Crzr
  • Target Unid:  B7ZKE3
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5DW47-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000812_AF2.pdbhor000812_ESM.pdb

Physical Information

Mass: 1147334 Formula: C432H670N130O136S3
Absent amino acids: Common amino acids: N
pI: 8.23 Basic residues: 10
Polar residues: 33 Hydrophobic residues: 24
Hydrophobicity: -87.09 Boman Index: -21970
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 66.98
Instability Index: 5426.16 Extinction Coefficient cystines: 8605
Absorbance 280nm: 101.24

Literature

  • PubMed ID:  NA
  • Title:  NA